Loading...
Statistics
Advertisement

Institut für 90°®-Lösungen - Konfliktmanagement, Lösungsfindung ...
www.institut-pp.de/
Das Institut für "90°®-Lösungen erarbeitet mit der "90°®-Methode" Lösungen für Konflikte in Firmen.

Institut-pp.de

Advertisement
Conversion Technology Metas Server
Institut-pp.de is hosted in Germany . Institut-pp.de doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Javascript, Number of used javascripts: 1. First javascripts: X5engine.js, Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Institut-pp.de

Technology

Number of occurences: 3
  • CSS
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 1
  • x5engine.js

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Institut-pp.de

Missing HTTPS protocol.

    Meta - Institut-pp.de

    Number of occurences: 11
    • Name:
      Content: 0
    • Name: description
      Content: Das Institut für "90°®-Lösungen erarbeitet mit der "90°®-Methode" Lösungen für Konflikte in Firmen.
    • Name: keywords
      Content: Teamentwicklung, Konfliktmanagement, Lösungsfindung, Innovationstraining, Lebensglück, Entwicklung, Wachstum, Problemlösung
    • Name: Author
      Content: Text: Ludwig-Koneberg, Design: Frank Gnifke
    • Name: Generator
      Content: Incomedia WebSite X5 Evolution 7.0.11 - www.websitex5.com
    • Name: MSSmartTagsPreventParsing
      Content: True
    • Name: Resource-Type
      Content: document
    • Name: Distribution
      Content: global
    • Name: Robots
      Content: index, follow
    • Name: Revisit-After
      Content: 21 days
    • Name: Rating
      Content: general

    Server / Hosting

    • IP: 217.160.223.44
    • Latitude: 51.30
    • Longitude: 9.49
    • Country: Germany

    Rname

    • ns-de.1and1-dns.org
    • ns-de.1and1-dns.com
    • ns-de.1and1-dns.de
    • ns-de.1and1-dns.biz
    • mx01.kundenserver.de
    • mx00.kundenserver.de

    Target

    • hostmaster.kundenserver.de

    HTTP Header Response

    HTTP/1.1 200 OK Date: Fri, 20 May 2016 22:05:18 GMT Server: Apache Last-Modified: Sat, 29 Aug 2009 12:33:36 GMT ETag: "497159ae-3337-4724702704800" Accept-Ranges: bytes Content-Length: 13111 Content-Type: text/html X-Cache: MISS from s_lu10 X-Cache-Lookup: MISS from s_lu10:80 Via: 1.1 s_lu10 (squid/3.5.12) Connection: keep-alive

    DNS

    host: institut-pp.de
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 217.160.223.44
    host: institut-pp.de
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns-de.1and1-dns.org
    host: institut-pp.de
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns-de.1and1-dns.com
    host: institut-pp.de
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns-de.1and1-dns.de
    host: institut-pp.de
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns-de.1and1-dns.biz
    host: institut-pp.de
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns-de.1and1-dns.de
    5. rname: hostmaster.kundenserver.de
    6. serial: 2016042800
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 1800
    host: institut-pp.de
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx01.kundenserver.de
    host: institut-pp.de
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx00.kundenserver.de
    host: institut-pp.de
    1. class: IN
    2. ttl: 3600
    3. type: AAAA
    4. ipv6: 2001:8d8:1000:60e2:888e:bec4:919c:3e

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.nstitut-pp.de, www.irnstitut-pp.de, www.rnstitut-pp.de, www.ifnstitut-pp.de, www.fnstitut-pp.de, www.ivnstitut-pp.de, www.vnstitut-pp.de, www.iknstitut-pp.de, www.knstitut-pp.de, www.i,nstitut-pp.de, www.,nstitut-pp.de, www.ibnstitut-pp.de, www.bnstitut-pp.de, www.ignstitut-pp.de, www.gnstitut-pp.de, www.itnstitut-pp.de, www.tnstitut-pp.de, www.iynstitut-pp.de, www.ynstitut-pp.de, www.iunstitut-pp.de, www.unstitut-pp.de, www.ijnstitut-pp.de, www.jnstitut-pp.de, www.imnstitut-pp.de, www.mnstitut-pp.de, www.innstitut-pp.de, www.nnstitut-pp.de, www.istitut-pp.de, www.innstitut-pp.de, www.institut-pp.de, www.inhstitut-pp.de, www.ihstitut-pp.de, www.injstitut-pp.de, www.ijstitut-pp.de, www.inkstitut-pp.de, www.ikstitut-pp.de, www.inlstitut-pp.de, www.ilstitut-pp.de, www.in stitut-pp.de, www.i stitut-pp.de, www.intitut-pp.de, www.insetitut-pp.de, www.inetitut-pp.de, www.inswtitut-pp.de, www.inwtitut-pp.de, www.insdtitut-pp.de, www.indtitut-pp.de, www.insxtitut-pp.de, www.inxtitut-pp.de, www.insftitut-pp.de, www.inftitut-pp.de, www.insgtitut-pp.de, www.ingtitut-pp.de, www.insttitut-pp.de, www.inttitut-pp.de, www.insitut-pp.de, www.instqitut-pp.de, www.insqitut-pp.de, www.instaitut-pp.de, www.insaitut-pp.de, www.inst itut-pp.de, www.ins itut-pp.de, www.instwitut-pp.de, www.inswitut-pp.de, www.insteitut-pp.de, www.inseitut-pp.de, www.instzitut-pp.de, www.inszitut-pp.de, www.instxitut-pp.de, www.insxitut-pp.de, www.instcitut-pp.de, www.inscitut-pp.de, www.insttut-pp.de, www.instirtut-pp.de, www.instrtut-pp.de, www.instiftut-pp.de, www.instftut-pp.de, www.instivtut-pp.de, www.instvtut-pp.de, www.instiktut-pp.de, www.instktut-pp.de, www.insti,tut-pp.de, www.inst,tut-pp.de, www.instibtut-pp.de, www.instbtut-pp.de, www.instigtut-pp.de, www.instgtut-pp.de, www.instittut-pp.de, www.instttut-pp.de, www.instiytut-pp.de, www.instytut-pp.de, www.instiutut-pp.de, www.instutut-pp.de, www.instijtut-pp.de, www.instjtut-pp.de, www.instimtut-pp.de, www.instmtut-pp.de, www.instintut-pp.de, www.instntut-pp.de, www.instiut-pp.de, www.institqut-pp.de, www.instiqut-pp.de, www.institaut-pp.de, www.instiaut-pp.de, www.instit ut-pp.de, www.insti ut-pp.de, www.institwut-pp.de, www.instiwut-pp.de, www.institeut-pp.de, www.instieut-pp.de, www.institzut-pp.de, www.instizut-pp.de, www.institxut-pp.de, www.instixut-pp.de, www.institcut-pp.de, www.insticut-pp.de, www.institt-pp.de, www.instituwt-pp.de, www.institwt-pp.de, www.instituet-pp.de, www.institet-pp.de, www.institust-pp.de, www.instituat-pp.de, www.institat-pp.de, www.institu-pp.de, www.institutq-pp.de, www.instituq-pp.de, www.instituta-pp.de, www.institua-pp.de, www.institut -pp.de, www.institu -pp.de, www.institutw-pp.de, www.instituw-pp.de, www.institute-pp.de, www.institue-pp.de, www.institutz-pp.de, www.instituz-pp.de, www.institutx-pp.de, www.institux-pp.de, www.institutc-pp.de, www.instituc-pp.de, www.institutpp.de, www.institut-tpp.de, www.instituttpp.de, www.institut-gpp.de, www.institutgpp.de, www.institut-hpp.de, www.instituthpp.de, www.institut-upp.de, www.institutupp.de, www.institut-jpp.de, www.institutjpp.de, www.institut-xpp.de, www.institutxpp.de, www.institut-spp.de, www.institutspp.de, www.institut-app.de, www.institutapp.de, www.institut-pp.de, www.institutpp.de, www.institut- pp.de, www.institut pp.de,

    Other websites we recently analyzed

    1. sinaidesert.com
      Switzerland - 141.8.225.124
      Server software: Apache
      Technology: Html
    2. Hoedown Time
      Line dancing
      United States - 75.98.17.66
      Server software: Webs.com/1.0
      Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, Google Analytics
      Number of Javascript: 6
      Number of meta tags: 5
    3. avalonspb.ru - Diese Website steht zum Verkauf! - Informationen zum Thema webarchiv.
      Diese Website steht zum Verkauf! avalonspb.ru ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf avalonspb.ru alles. Wir hoffen, dass Sie hier das Gesuchte finden!
      Germany - 82.98.86.164
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 5
    4. DrinK.TeaM
      Team de poivrons - Have a drink
      France - 91.121.119.173
      Server software: Apache
      Technology: Html, Iframe, Javascript, Php, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 5
    5. media-magnat.com
      Ukraine - 91.200.40.52
      Server software: nginx/1.2.1
      Technology: Html
    6. sriswamisamarthvishwakalyankendra.org
      Santa Ana (United States) - 107.6.45.89
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 8
      Number of meta tags: 2
    7. Home
      Germany - 82.165.217.52
      Server software: Apache
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, Facebook Box, Twitter Button
      Number of Javascript: 2
      Number of meta tags: 2
    8. Welcome to buahkaleng.com
      Welcome to buahkaleng.com
      Miami (United States) - 104.238.136.38
      Server software: nginx
      Technology: Google Adsense, Javascript, Php
      Number of Javascript: 5
      Number of meta tags: 4
    9. Финансовый портал – кредиты, ипотека, кредитные карты
      Финансовый портал – кредиты, ипотека, кредитные карты
      Russian Federation - 80.78.250.26
      Server software: nginx
      Technology: CSS, Google Font API, Html, Javascript, jQuery, MooTools, Php, Yandex.Metrika, Google Analytics
      Number of Javascript: 4
      Number of meta tags: 4
    10. huyan.com
      New York (United States) - 69.172.201.208
      Server software: DOSarrest
      Technology: Html, Javascript
      Number of meta tags: 1

    Check Other Websites